SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338607 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338607
Domain Number 1 Region: 52-187
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 4.67e-27
Family 4HBT-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338607
Sequence length 208
Comment C8orf55 (Homo_sapiens) UPF0670 protein C8orf55 Precursor (Mesenchymal stem cell protein DSCD75)
Sequence
MLGLLVASLTLALAFFALLDGWYLLRVPCALLRARLLEPRVRDLLAEQRRAGRVLPSDLD
LLLHMNNARYLREADVARIAHLTRCGVLGALRELGGHSVLAASCSRYRRSLHLFEPFEVR
TRLLGWDDRAFFLEARFISLRDGFVCALLRSRQHVLGTSPERIVQHLCKRRVEPPELPED
LKHWITYNEVSSQLLRAESRLSEDTKDQ
Download sequence
Identical sequences G5C8X6
HGL_H00000338607 XP_004837926.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]