SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338770-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338770-1
Domain Number 1 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 428-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 623-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.87e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 172-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 6 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 1-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-19
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 10 Region: 134-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.71e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 11 Region: 474-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000383
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 12 Region: 331-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000675
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338770-1
Sequence length 682
Comment ZNF420 (Homo_sapiens) zinc finger protein 420
Sequence
LVTFRDVALNFSQEEWEWLDPSQKDLYREVMLENYKNLVWLDWESWCEMKELSSKWFTDE
EEISQGMALERIKSHGLQCSNFREACKYEGEFAWHQGNQERHFRQVTTLKDISTGKRHNE
YNNSRRSIPLEGEKPYACNDCGKAFTHNFFLREHQRTHNGEKPYECKECNKAFRQSAHLA
QHQRIHTGEKPFACNECGKAFSRYAFLIEHQRIHTGEKPYECKECNKAFRQSAHLNQHQR
IHTGEKPYECSQCGKAFSRRIALTLHQRIHTGEKPFKCNECGKTFGYRSHLTQHQRIHTG
EKPYECMKCGKFFRTDSQLNRHHRIHTGERPFECSKCGKAFSDALVLIHHKRSHAGEKPY
ECNKCGKAFSCGSYLNQHQRIHTGEKPYECNECGKAFHQILSLRLHQRIHVGEKPYKCNE
CGNNFSLFSQSSSLTLHQRIHTGEKPYKCVECGKAFSQRSNLVQHHRIHTGEKPYECKEC
RKAFSQNAHLVQHLRVHTGEKPYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAF
SNRSSIAQHQRVHTGEKPYECNVCGKAFSLRAYLTVHHRIHTGERPYECKECGKTFSQNS
HLAQHQRIHTGEKPYKCQECRKAFSQIAYLAQHQRVHTGEKPYECIKCGKAFSNDSSLTQ
HQRVHTGEKPYECNVCGKAFSY
Download sequence
Identical sequences G5AMD3
HGL_H00000338770-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]