SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338770-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338770-2
Domain Number 1 Region: 115-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.87e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 200-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 467-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 60-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 162-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000305
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000942
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338770-2
Sequence length 528
Comment ZNF420 (Homo_sapiens) zinc finger protein 420
Sequence
MMENYGNLISLGHSISKPDVITLLEQGKEPWMVGREETRKLGEDLESRYEKVSYGKVHLF
RKHSSVTLHQRINNSEKSFECDRCGKAFTRHTDLIVHQRIHTGEKPYECKQCGKAFNRAS
NLLQHQKIHTGEKPYKCEECGMTFSRNIDLRVHQRIHTGEKPYQCKECGKAFSRASYLTQ
HRKVHTGEKSYVCHECGKAFSKGGKLKIHQRIHTGEKPYECKACGKTFSQASHLVQHDRI
HTGEKPYECHECGMTFSRGIDLRVHHRIHTGEKPCKCKECGKAFSCTSNLVQHERIHTGK
KPYECEECGMTFSRIYQLIPHQRMHTGVKPFECKECGKAFSRTSALIQHERMHTGEKPYK
CKDCGKAFIHGGSLKIHQKIHTGEKPYECKECGKAFRRTSDLVRHERIHTGEKPYKCQEC
WKAFGHIESLRMHHRLHTGEKPYECKECGKSFKSSHQLTVHQRIHTGEKPYECKECGKAF
SVYTRLTRHQSIHSGEKPFQCNKCGKFFRLNSSLKVHQRIHTREKPYQ
Download sequence
Identical sequences G5AMC7
HGL_H00000338770-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]