SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338785 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338785
Domain Number 1 Region: 589-800
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00061
Further Details:      
 
Domain Number 2 Region: 841-993
Classification Level Classification E-value
Superfamily Bet v1-like 2.33e-42
Family STAR domain 0.000000103
Further Details:      
 
Domain Number 3 Region: 13-55
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000612
Family Variant SAM domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338785
Sequence length 1005
Comment STARD13 (Homo_sapiens) StAR-related lipid transfer (START) domain containing 13
Sequence
MEQTLPWREHTADHSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASMKLDVNLQK
KKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLHTLFPGRDRNGSPGGPRMRNTTSSESVL
TDLSEPEVCSIHSESSGGSDSRSQSGQYCADSPGMLEGTLVSSSLPQNPRDILNYPFYPK
NEKPTRTRAKSFLKRMETLRAKGAHGRHKGSGRTGGLVISGPVLQQEPESFKAMQCIQIP
NGDLRNSPPAVCRKGLPCSSKSSGESSPSENSSSGVSTPCLKERKCHHEANKRSGMYLED
LDVLSGTALRDAGGQNHTHGFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDNSNGVNW
RTGNISLGSQQGPGTREPRLMASCHRASRVSVYDNVPGSHLCASTGDLLDLGKDFPQLDD
ILQHVSGLQEVVDDWSKNVLPDLQSHDPLVGEPGLHPFPSSNQITLDFEGNSVSEGRTTP
SDVERDGTSLNESEATGVRERRDSGVGASLTRPSRRLQWNSFQPSQQPQPSPASPHISSQ
TASQLNLLQRFSLLRLTAIMEKYSMSNKHGWTWSVPKFMKRTKVPDYKDKAVFGVPLIVH
VQRSRQPLPQSIQQALIYLRSNCLDQVGLFRKSGVKSRIHALRQMNESFPENVSYEDQSA
YDVADMVKQFFRDLPEPLFTNKLNETFLHIYQFVPKEQRLQAVQAAILLLADENREVLQT
LLCFLNDVVNLVDENQMTPMNLAVCLAPSLFHLNLSKKESSPRVIQKKYATGKPDQKDLN
ENLAAAQGLAHMIMECNKLFEVPHEMVAQSRNSYVEAEIHVPTLEDLGTQLEESGATFHT
YLEHLVQGLQKEAKEKFKGWVTCSSPDNTDLAFKKWKVVETLDRQTEIYQYVLNSMAPHP
SRDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQLMGAVRAVVMDSQYLIEPCGSGKSRLTH
ICRIDLKGHSPEWYSKGFGHLCAAEVARIRNSFQPLIAEGPETKI
Download sequence
Identical sequences G5BB51
HGL_H00000338785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]