SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338885 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338885
Domain Number 1 Region: 282-400
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000255
Family Synaptotagmin-like (S variant) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338885
Sequence length 707
Comment C2CD2L (Homo_sapiens) C2CD2-like
Sequence
MDPGWRQPDVGWAALLILFAASLLTVLGWLLQYARGLWLARARGGRGPGPALAAEPGGSL
RELGVWRSLLRLRATRAGAPEEPGVRGLLASLFAFKSFRENWQRAWVRALNEQACRDGSS
IQIAFEEVPQLPPTASIGHVTCIDQSEHTMVLHCQLSAEEVRFPVSVTQQSPAAVSMETY
HVTLTLPPTQLEVNLEEIPGEGLLVSWAFTDRPDLSLMVLPKLQAREKGEEQGELSTIEE
LIKDAIVSTQPAMMVNLRACSAPGGLVLGEKPPMISQAQPACPRPTRLFLQQLRASHLGS
ELGDIEELCCVAELDNPMQQKWTKPVRAGPEVEWTEDLSLDLGPQSRELTLKVLRSSSCR
DTELLGQATLPVGSPSRPLSRRQVCPLTPGPGKALGPAATMAAELHYEEGSPRNLGTSTP
STPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRVDGKLDSPSRSPSKVEVTEKTTT
VLSESSGPSNASHNSSPGESHLSNGLDPVAETAIRQLTEPSGRAAKKTPTKRSTLIISGV
SKVPIAQDELALSLGYAASLEASVQDDAGTSGGPSSPPSDPPAMSPGTIDALSSPTSVQE
ADETTRSDISERPSVDDVESETGSTGALETRSLKDHKVSFLRSGTKLIFRRRPRQKEAGL
SQSHDDLSNTTATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
Download sequence
Identical sequences G5BHN7
XP_004856829.1.39548 HGL_H00000338885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]