SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000339404 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000339404
Domain Number 1 Region: 54-140
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000511
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000339404
Domain Number - Region: 135-279
Classification Level Classification E-value
Superfamily LigT-like 0.000785
Family 2'-5' RNA ligase LigT 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000339404
Sequence length 357
Comment ASCC1 (Homo_sapiens) activating signal cointegrator 1 complex subunit 1
Sequence
MEVLRPQIITIDGRNYRKNPIQEKIYQHEEDEEDFYQDSMEGADEPCDAYEVEQTAQGFR
ATVSAPSVLYKHIVGKRGDTKKKIEMETKTSITIPKPGLDGEIVIAGQHRNGVISARTRI
DVLLDTFRRKQPFTHFLAFFLNEAEVQEGFLKFQEKVLEKCSKDRGVDSSVFQNSKKLHL
TIGMLVLLSEQEIQQTREMLQRCKEEFINDIAGGKPLEVEMAGIEYMNDDPGMVDVLYAK
VHMKDGSNRLQELVDRVLERFQASGLIVKEWSSVKLHATVMNTLFRKDPNAEGRYNLYTA
DGKYIFKERESFDGRNILKLFENFHFGSLKLNSIHISQRFTVDSFGNYASCGQIDFS
Download sequence
Identical sequences G5C2I4
XP_004846296.1.39548 HGL_H00000339404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]