SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000339585-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000339585-1
Domain Number 1 Region: 25-115
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.17e-31
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 445-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000354
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 331-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000678
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 401-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000107
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000339585-1
Sequence length 503
Comment ZNF449 (Homo_sapiens) zinc finger protein 449
Sequence
IAMEEGLEIQTSLLSTRDPMLQDANTDCEVSRMHFRQFQYSEAAGPWENFHRLWELCCQW
LKPKVRSIEQVLELLVLEQFLTILPTEIESRVSAYGPESREKLFALIEHLQRERETTGHQ
FDMRDVLFDELAPFRMVPPLPEMRLEPPALPLMGPVQEALVPGAWSPQAGPLGLNYGAAG
ECLHLLDPGHAVPQSDWSYSLEPGLELYTEELQDSESLEQSSDSKRGRAEKLERLSPIFP
SLDRNDLCGRNLLNNCEHLEVPQKTSSEELLSIGVEKPCLGQASQSADQKLPLKPRANKQ
KPNTTNPYCYPPCAQQFAYNRPLPCYPKIQTGEPAYKCHKCGRQFLHQSDLDKHQHTHTK
EKPFQCTQCSMQFTQLAHLTQHESKHLQKQSYQCPVCRQNFALWSSLTEHRKTHNEXXXX
KSHECQTCGKCFSQRATLLQHQRIHTAERQFICDYGPKSYRYRSSLIIHRRTHTGEKPYK
CSLCFKGFIKKADLTTHQAAHFR
Download sequence
Identical sequences G5BW12
HGL_H00000339585-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]