SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000339585-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000339585-2
Domain Number 1 Region: 22-112
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.46e-36
Family SCAN domain 0.0000888
Further Details:      
 
Domain Number 2 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 319-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000339585-2
Sequence length 518
Comment ZNF449 (Homo_sapiens) zinc finger protein 449
Sequence
MAVALGCAIQASLNQGSVLQEYDTDCEVFRQRFRQFQYTEAAGPHEAFNKLWELCCQWLK
PKMRSKEQILELLVLEQFLTILPTEIETWVREHCPENRERVVSLIEDLQRELEIPEQQVD
MHDILLEELAPVGTVPMPPDMHLESPALQVMGPVPEASVTEAWIPQAGPQELNYGDAGTC
QPFLDTGYPLPKLDVNFPLEQREEPWVKELQDSKEMKQLLDSKIGFDMGLENEEDASKQK
KLENIYPFIVTLEGNSLHGPVMEKDYVPLENQWELPPEDLQTDLTKLVDQQNPTLGETLE
SSSLEEPLNPRPQKKKNPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEPHKCPECGKRF
LRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGS
SLKRHLKTHTGEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI
HLRIHTGEKPYKCSHCSKSFRQRAGLIMHQVTHFRGLL
Download sequence
Identical sequences G5C972
HGL_H00000339585-2 XP_004875319.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]