SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000339767 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000339767
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 2 Region: 58-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000607
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 98-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000407
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000339767
Sequence length 132
Comment ZNF433 (Homo_sapiens) zinc finger protein 433
Sequence
MEAVTFEDVTVTFTMEEWALLNPSQKKLYRDVMQETFRNMATVGGNWEKQKNEEEQIHCQ
THEEGHQGEKPYVFKKCGKALSTNKYCQIHGRNHTGEKPYICKQCGKAFSTNKYHQIYER
THTGGKPYTCKQ
Download sequence
Identical sequences G5C1J0
HGL_H00000339767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]