SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000339826 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000339826
Domain Number - Region: 264-272,323-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000195
Family Ankyrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 611-668
Classification Level Classification E-value
Superfamily OmpH-like 0.0288
Family OmpH-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000339826
Sequence length 783
Comment PIK3AP1 (Homo_sapiens) phosphoinositide-3-kinase adaptor protein 1
Sequence
GAPRRCDILTVYSPDAEEWCQYLQDLFLSSRQVRTQKMLTHRLGPDASFSAEDLLLFLGA
RCVVVLLSAELVEHFYRPALLPLLQRALHPPHRVVRLLCGVQGTQDEFLPFFPDWAHWQE
LTCDDEPEAYVAAVRKAISEDSGCDSVTDTEPEEENHSKRQSLLTTEASGNLMVVQPDRI
RCGVETTVYVIVRCKLDERVATEAEFSPEDSPSVRVEAMLENEYTVSVRAPDLSSGNVCL
KIYSGDLVVCESIISYYTDMEEIENLLSNAANPVEFMCQAFKIVPYNTETLDKLLTESLK
NNIPASGLHLFGINQLEEEDMMTNQRNEELPTLLHFAAKYGLKNLTALLLTCPGALQAYS
VANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDMLKSHIKEELMHGEEADSVYESMAHLS
TDLLMKCSLNPGCDEELYESMAAFAPGATEDLYVEMLQANTSNTVSGDGFSRPTKDSMIR
KFLEGNSIGMAGLERDQYHLGEEEDVYHTVEDDETFCMDLASRPPVPVPRPEASAAGAHQ
LPDNEPYISKGKFFAEKSQEQPGNLYISSESLRKESPVRLWRDRPQSSIYDPFAGMKTPG
QRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRRQKEK
QKSGKQTDLEITVPIRHSQHLPGKVEFGVYESSPRKSVFPSRTELRRGDWKTDSTSSTAS
SMSNRSSTRSLLSVSSGMEGDNEDNEVSEVTRTRSPGPQQVDGTHTVPFERPPRVPPRAA
SQR
Download sequence
Identical sequences G5BEU1
HGL_H00000339826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]