SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000339952 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000339952
Domain Number 1 Region: 640-926
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-57
Family Protein kinases, catalytic subunit 0.0000108
Further Details:      
 
Domain Number 2 Region: 388-456
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000339952
Sequence length 947
Comment KSR2 (Homo_sapiens) kinase suppressor of ras 2
Sequence
MDEENMTKTEEQQPLSLQKALQQCELVQNMIDLSISNLEGLRTKCATSNDLTQKEIRTLE
SKLVKYFSRQLSCKKKVALQERNAELDGFPQLRHWFRIVDVRKEVLEEISPGQLSLEDLL
EMTDEQVCETVEKYGANQEECARLNASLSCLRNVHMSGGNLSKQDWIIQWPTTEPGKENN
PVCPPEPTPWIRTHLSQSPRVQSKCVQHYCHTSPTPGAPVYTHVDRLTVDAHPGLCPPPP
LESGHRSLPPSPRQRHAVRTPPHTPNIVTTVTPPGTPPTRRKNKLKPPGTPPPSSRKLIH
LIPGFTALHRSKSHEFQLGHRVDEAHTPKAKKKSKPLNLKIHSSVGSCENIPSQQRSPLL
SERSLRSFFVGHAPFLPSTPPVHSEANFSANTLSVPRWSPQIPRRDLGNSIKHRFSTKYW
MSQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPCHLLIIHRGARLVRTESVPCDINNP
VRKPPRYSDLHISQTLPKTNKINKDHIPVPYQPDSSSNPSSTTSSTPSSPAPPLPPSATP
PSPLHPSPQCTRQQKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPIL
EGNPLLQIEVEPTSENEEGHDEAEESEDDFEEMNLSLLSARSFPRKASQTSIFLQEWDIP
FEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDNEDQLKAFKREVMAYRQTRHENV
VLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEIVKGMGYLHAKGI
LHKDLKSKNVFYDNGKVVITDFGLFSISGVLQAGRREDKLRIQNGWLCHLAPEIIRQLSP
DTEEDKLPFSKHSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGMKPNLSQIGMGKE
ISDILLFCWAFEQEERPTFTKLMDMLEKLPKRNRRLSHPGHFWKSAE
Download sequence
Identical sequences G5AKT0
HGL_H00000339952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]