SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000339959-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000339959-1
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.02e-26
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000339959-1
Sequence length 61
Comment ZNF595 (Homo_sapiens) zinc finger protein 595
Sequence
GLVMFEDVAIDFSKEEWECLAPSQRNLYRDVMLENYNTFISLGLATSKPSVISLLEQGKE
P
Download sequence
Identical sequences G5AMD0
HGL_H00000339959-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]