SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000339960-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000339960-2
Domain Number 1 Region: 175-372
Classification Level Classification E-value
Superfamily E set domains 1.49e-78
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000362
Further Details:      
 
Domain Number 2 Region: 68-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-22
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000339960-2
Sequence length 419
Comment KCNJ5 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 5
Sequence
MAGDSRNAMNQDMEIGVTPRDPKKIPKQARDDTPLATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYIRGDLDH
VGDHEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIVLLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNHAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLPGGCAETGQDVEVEQDEEDEPDGLNGSWKTRGSV
Download sequence
Identical sequences G5BRN4
XP_004862671.1.39548 XP_004862672.1.39548 XP_004862673.1.39548 XP_004862674.1.39548 HGL_H00000339960-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]