SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340017-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340017-1
Domain Number 1 Region: 225-360
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-35
Family Synaptotagmin-like (S variant) 0.0000132
Further Details:      
 
Domain Number 2 Region: 59-188
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.25e-23
Family Synaptotagmin-like (S variant) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340017-1
Sequence length 369
Comment DOC2A (Homo_sapiens) double C2-like domains, alpha
Sequence
MAIDVSPGPIRPIRLISDYFPHFYPFAEPVLRTPDWLPAATPANGSTPQLQRDPEPEADS
DDSTALGTLEFTLLFDADNSALHCTAHRAKGLKPPASGSVDTYVKANLLPGPSKASQLRT
HTVRGTRGPVWEETLTYHGFTRQDAGRKTLRLCVCEDPRLRRRRQAPPLGELRVPLKKLV
PNRARSFDICLEKRRLTKRPKSLDSARGMSLYEEEVEAEVAGEERGRILLSLCYSSQRGG
LLVGVLRCAHLAPMDANGYSDPFVRLSFLHPNLGKKSKYKTSVRRKTLNPEFNEEFFYAG
PREELAKKTLLVSVWDYDLGTADDFIGGVQLSSQASGERLHHWRECLGRSDCRLELWHPL
DGVAPQLGN
Download sequence
Identical sequences G5BTW4
HGL_H00000340017-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]