SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340017-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340017-2
Domain Number 1 Region: 164-293
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.42e-35
Family Synaptotagmin-like (S variant) 0.000013
Further Details:      
 
Domain Number 2 Region: 5-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.14e-33
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340017-2
Sequence length 306
Comment DOC2A (Homo_sapiens) double C2-like domains, alpha
Sequence
MLEFDLLYDRASCTLHCSILRAKGLRPMDFNGLADPYVKLHLLPGACKANKLKTRTQRNT
LNPVWNEDLTYSGITDDDITHKVLRISVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHFNI
CLERQVPLASPSSMSAALRGISCYLKELEQAEQGPGSWXXXXXSLSYSSQRRGLLVGIIR
CAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIQLSTLATK
TLEVTVWDYDIGKSNDFIGGVSLGPGARGEARRHWSACLQQPDAPLERWHTLTSELPAAA
TALPSA
Download sequence
Identical sequences G5BYN7
HGL_H00000340017-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]