SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340176 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340176
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000231
Family Canonical RBD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340176
Sequence length 198
Comment RBPMS (Homo_sapiens) RNA binding protein with multiple splicing
Sequence
QVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNAL
NGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPALY
PSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQCFSPEAKPNTPVFCPLLQQIRFVSG
NVFVTYQPTADQQRELPC
Download sequence
Identical sequences D2HFK0 G5B4I0 G7N0U1 G7PD54
HGL_H00000340176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]