SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340466 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340466
Domain Number 1 Region: 348-696
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.25e-89
Family YicI catalytic domain-like 0.0000649
Further Details:      
 
Domain Number 2 Region: 698-780
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.58e-21
Family Putative glucosidase YicI, domain 3 0.006
Further Details:      
 
Domain Number 3 Region: 82-171,216-345
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.13e-16
Family YicI N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340466
Sequence length 918
Comment GANAB (Homo_sapiens) glucosidase, alpha; neutral AB
Sequence
MAARRSRSRMVLVLAYLGVFLGIAFAVDRSNFKTCEESSFCKRQRSLRPGLSPYHALLDS
LQLGPDALTVQLVHEVTKVVLLLELQGLQKNMTRIRIDELQPLRPRYRVPDVLVADPPTA
PLSVSGHDDNSMELTVAEGPYKVILTARPFRLDLLEGRSLLLSVNARGLLEFEHQRLRRV
PFSDKPETQQTAEREEPGAWEEMFKTHSDSKPHGPTSVGLDFSLPGIEHVYGIPEHADSL
RLKATEGGEPYRLYNLDVFQYEVDNPMALYGSVPVLLAHSPHRDLGIFWLNAAETWVDIS
SNTAGKTLFGKMLDYLQGSGETPQTDVRWMSESGIIDVFLLLGPSAFDVFQQYASLTGTQ
ALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHSLPCDVIWLDIEHADGKRYFTWDPSRF
PKPRSMLERLASKRRKLVAIVDPHIKVDSGYRVHEELRDQGLYVKTRDGSDYEGWCWPGS
AGYPDFTNPRMRAWWANMFSFDNYEGSAPNLYVWNDMNEPSVFNGPEVTMLKDAQHHGGW
EHRDIHNIYGFYVHMATADGLIQRSGGVERPFVLSRAFFAGSQRFGAVWTGDNTAEWDHL
KISIPMCLSLGLVGLSFCGADVGGFFKNPDPELLVRWYQMGAYQPFFRAHAHLDTGRREP
WLLPAQHQDIIREALGHRYSLLPYWYTLFYHAHRDGFPVMRPLWVQYPQDVTTFSIDDQF
LLGDALLVHPVSDAGAHGVQVYLPGPEEVWYDIQSYQKHRGPQTLYLPVTLSSIPVFQRG
GTIVPRWMRVRRSSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFS
FSNSTLVSSFADPRGHFETPVWIERVVIMGVEKPAAVVLQTRGSPESRLSFQHDPETSVL
VLRKPGVSVASDWSILLR
Download sequence
Identical sequences G5AYH8
HGL_H00000340466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]