SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340594 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340594
Domain Number 1 Region: 734-950
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 598-718
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000196
Family PLC-like (P variant) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340594
Sequence length 1116
Comment SYDE2 (Homo_sapiens) synapse defective 1, Rho GTPase, homolog 2 (C. elegans)
Sequence
MPLSRSRSLESLQVGAKLPPLQRWPSDSWIRWGAREDREEPPPRGGGMDGWSWGGSARAT
EPAGLLRPCTHGPGCSSRSPFRDPAQSSVIFSGKDSCQEEPPFLRPPAVTVKKLQKWMYK
GRLLSLGMKGRTRGPASKVPGARAASANPSTLKVHGNPDLSVPPDERITLTELFEDVYGS
SMKKRELEDLKDNVEFRGHKPLNNITVSKKRNWLYQSSLRALNLEEENKKYQNRSNLSIS
SVTPSYHQLSQPFLKSSEEYCTYMVCNATSSSLSRNCSLDFNEDNDADDEGEIWYNPIPE
DDDLGMSSALSFGVANTAVLKLPVSSLHIPSGSDLMKAAQYTEDLLCSSEHMGDIQSMEL
NEMNPINSIHSTEFIPQHKQRLGHKTQEGIMVEDSPVLKPHFAGPGILAAANRTELGVIE
PSSPSPTPIKKGSSINWSLPDKIKSPRTVRKLSMKMKKLPEFSRKLSVKGTLNYIHSPDS
TPSLSKYNCREVHHAVILPSGNTTTAAKRNVISRYHLDTTVSSQHSYQKKTLNSKYSCQG
GYLSDGDSPELITKSSKHGPENKFGKGKEIIPSSCNKNEIDIDAFRHYSFSDQPKCSQYI
SGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIEN
AQHLKLVVFSWEPTPRKNRVCCHGTVVLPTLFRVTRTHQLAVKLEPRGLIYVKVTLMEQW
ENSLLRLDKNRASVMFGVDIQKVVERENVGLMVPLLIQKCIVEIENRGCQVVGLYRLCGS
AAAVKELRQEAERDSKAVGLCENQYPDINVVTGVLKDYLRELPSPLITKQLYEAVLDAMV
KSPLKMSSNGCENDPCDSKYTVDLLNCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNL
AVCFGPVLLSQRQETSTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWPVQHLTIRESA
NSLFPEQSSSLNYLRRKKERPYMLNLSSTDSSGVLRPRQTRLDSPLSNRYAGDWSGCGEN
YFLNKKENLNDVDYDDVPSEDRENREDYSKMDGPEIMIEQPISTSRECTFQSYLTVQTIE
STVDQKVNLKDLQESIDTLIGNLERELNKNKLNMSI
Download sequence
Identical sequences G5C919
HGL_H00000340594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]