SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340660 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340660
Domain Number 1 Region: 116-164
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-16
Family Fibronectin type II module 0.0018
Further Details:      
 
Domain Number 2 Region: 55-110
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000428
Family Fibronectin type II module 0.0035
Further Details:      
 
Domain Number 3 Region: 10-55
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000657
Family Fibronectin type II module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340660
Sequence length 164
Comment ELSPBP1 (Homo_sapiens) epididymal sperm binding protein 1
Sequence
MPNLHQNVVRDYPRCVFPFIFCGRTYNSCNSDGSFTGKMWCSVTSSFDEKQQWKYHEMNE
YGGNSFSKPCIFPSKYRNKGISECLEDESNKLWCPTTENMDKDGKWSFCADTRISSTAPG
FPCHFPFNYKNKNYFNCTTKGSKDNLMWCATSYNYDQDHTWVDC
Download sequence
Identical sequences G5B897
HGL_H00000340660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]