SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340836-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340836-1
Domain Number 1 Region: 60-172
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.55e-30
Family Ankyrin repeat 0.00088
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-21
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340836-1
Sequence length 203
Comment OSTF1 (Homo_sapiens) osteoclast stimulating factor 1
Sequence
GQVKVYRALYTFEPRTVNELYFEEGDIIYITDMSDSNWWKGTAKGKTGLIPSNYVAEQAE
SIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEVLFTQPNI
ELNQQNKLGDTPLHAAAWKGYADIVQLLLEKGARTDLRNNEKKLALDMATNAACASLLKK
KQGADAIRSLSNAEDYLDDEDSD
Download sequence
Identical sequences G5BHT6
HGL_H00000340836-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]