SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340836-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340836-2
Domain Number 1 Region: 95-153
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-24
Family SH3-domain 0.0000256
Further Details:      
 
Weak hits

Sequence:  HGL_H00000340836-2
Domain Number - Region: 5-51
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000185
Family Calponin-homology domain, CH-domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340836-2
Sequence length 188
Comment OSTF1 (Homo_sapiens) osteoclast stimulating factor 1
Sequence
MHVSFLSVAYKYRCAQVFDPDDLYSGVNFSKVLTTLLAVNKATEDQLSERPCGRSSSLST
ANSSQTSPQRAVSSTAPGLQKQAKAVEMTENGSHQLIVKARFNFKQTNEDELSVCKGDII
YVTRIEEGGWWEGTLNGRTGWFPSNYVREIKPSADFYPLLHASIDIIWLMALILMYLTVM
PCSSLATP
Download sequence
Identical sequences G5CAT8
HGL_H00000340836-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]