SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340913-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340913-1
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000315
Family Ankyrin repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340913-1
Sequence length 622
Comment TRPC6 (Homo_sapiens) transient receptor potential cation channel, subfamily C, member 6
Sequence
REALNLAIRLGHEAITDMLLANVKFDFRQVHEALLVAVDTNQPAVVRRLLARLDREKGRK
VDTRSFSLAFFDSSIDGSRFAPGVTPLTLACQKDLYEIARLLMDQGHTIAWPHPISCACL
ECSNARRYDLLKFSLSRINTYRGIASRAHLSLASEDAMLAAFQLSRELRRLARKEPEFKP
EYIALESLCQDYGFELLGMCRNQSEVTAVLNDLAEDSEVEPAAEGLGQAFEEGIPNLARL
RLAVNYNQKRFVAHPICQQVLSSIWCGNLAGWRGSTTIWKLFIAFLIFLTMPFLCIGYWL
APKSRLGRLLKIPVLKFLLHSASYLWFLIFLLGESLAMEMQLSTFSGRSKSVWETSLHMI
WVTGFLWFECKEVWIEGLRSYLLDWWNFLDVVILSLYLAAFALRLLIAGLALVSCRDASD
SAACRYFTTAERSEWRTEDPQFLAEVLFAVTSMLSFTRLAYILPAHESLGTLQISIGRMI
DDMIRFMFILMIILTAFLCGLNNIYVPYQETEQLGNFNETFQFLFWTMFGMEEHKVVDMP
QFLVPEFVGRALYGIFTIVMVIVLLNMLIAMITNSFQKIEDDADVEWKFARSKLYLSYFR
EGLTLPVPFNILPTPKAFFYLL
Download sequence
Identical sequences G5AVS8
HGL_H00000340913-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]