SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340914 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340914
Domain Number 1 Region: 298-407
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-38
Family Synaptotagmin-like (S variant) 0.00000617
Further Details:      
 
Domain Number 2 Region: 434-568
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.82e-35
Family Synaptotagmin-like (S variant) 0.000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340914
Sequence length 590
Comment SYT3 (Homo_sapiens) synaptotagmin III
Sequence
MSGDYEEDLCRRALILVSELCARFRDTDTRDRCQEFNSRIPGYPRGPDAVTLTPDLYISV
SLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGG
HLGTGLGGHPLLGGHHAHAHAAQHPPFAELLEPGGLGGSDPPEPSYLDMDSYPEAAAAAV
VAAGVKPSQTSPELPSEAGAGSGLLLLPPSGGGLPSAQSHHQVTSLAPSTRYPALPRPLT
QQTLTTQSDPSSEERPPPPPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGGSGEAGT
PCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRK
TLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPL
WRDIMEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISE
GRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYIGHNEVIGVCRVGPE
AADPHGREHWAEMLANPRKPVEHWHQLVEEKTLTSFTKGGKGLSEKENSE
Download sequence
Identical sequences G5B8T2
HGL_H00000340914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]