SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341082 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341082
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.36e-36
Family Ribosomal protein L20 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341082
Sequence length 149
Comment MRPL20 (Homo_sapiens) mitochondrial ribosomal protein L20
Sequence
MVFLTTRLYLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARKLK
KRNLRTLWINRITGASQEHGLKYWVFVTNLIKCQVELNRKVLADLAIYEPKTFKSLAALA
QRRRQEGFAAALGDGKEPEGIFSRVVHYH
Download sequence
Identical sequences G5ATP8
HGL_H00000341082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]