SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341136 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341136
Domain Number 1 Region: 148-219,266-522
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.77e-92
Family NadC C-terminal domain-like 0.0000192
Further Details:      
 
Domain Number 2 Region: 15-147
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.91e-35
Family NadC N-terminal domain-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341136
Sequence length 546
Comment NAPRT1 (Homo_sapiens) nicotinate phosphoribosyltransferase domain containing 1
Sequence
MAAERDSEGLAAARPMLTDLYQATMALGYWRAGRARDPAEFELFFRRCPFGGAFALAAGL
RDCLRFLRTFRLQDEDVQFLASVLPRDTDPAFFQDLRSLDCSAVTLRALPEGSLAFPGVP
LLQVSGPLLLLQLLETPLLCLISYASLVATNAARFRLIAGPDKRLLELGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFITSFSGCEVPSDPMLAPAVGESPGV
DLAASVKLWLERVCACLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDSYSVRRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAQEIRGVFRTVAAQFQMPWLESVLIAVSNNIDE
EELARLAQEGSEVDVIGIGTSVVTCPQQPSLGCVYKLVSVGGQPRMKLTEDPDKQTLPGS
KAAFRLLASDGSLLLDLLQLAEEPPPQAGQDLRVWPRGAQEPCTVRPAQVEPLLQLWLQQ
GQLCEPLPSLTESRAFAQWSLSRLSPAHRQLQNPALYQVGTGPGVGCPCVLCPIAAHQPP
SLLPAG
Download sequence
Identical sequences G5AWF4
HGL_H00000341136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]