SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341151 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341151
Domain Number 1 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.76e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 586-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 265-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000573
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 9 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000706
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341151
Sequence length 643
Comment ZNF81 (Homo_sapiens) zinc finger protein 81
Sequence
QVLVSFEDVTVDFSREEWQQLDSTQRCLYHDVMLENYSHLLSLGFEVPKPEIIFKLEHGE
EPWMWEDTPHHDCSGGTFGMKNSEKKESGKTTFHSEIEGDDTRDNSLCSILEELSQDAER
IKRCQEKWDNSLNHTAFVNKKILNTEWDYDSRDIDKCIHLSPNLIPSQKRPHIHESFGKH
FKHNLDFYIHNKNNATKNFDKIIGHSQVFAQSTSYAAHENVHTEAKFCESDQCGKVLSFK
HTSSQNLKFPVREKANTCTEFGKIFTHKSHLFVPPRIHPVEKPHELNKCVNVFTQKPLLS
IYLRVHREEKLYICTKCGKAFIQNSELLMHEKIHTREKPYKCSECGKSFFQVSSLLRHQT
AHSGEKLYECSECGKGFSLNSALNVHQKIHTGERHHKCSECGKAFTQKSTLRMHQRIHTG
ERSYVCTECGQAFIQKAHLIAHQRIHTGEKPYECSDCGKSFPSKSQLQMHKRIHTGEKPY
VCTECGKAFTNRSNLNTHQKSHTGEKSYICAECGKAFTDRSNFNKHQTIHTGEKPYVCAD
CGRAFIQKTELITHQRIHTAEKPYKCSDCDKSFSKKPHLKVHQRIHTGEKPYICAECGKA
FTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQKSVLSMHRNIHT
Download sequence
Identical sequences G5B0C9
HGL_H00000341151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]