SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341382-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341382-1
Domain Number 1 Region: 575-781
Classification Level Classification E-value
Superfamily Smc hinge domain 1.57e-50
Family Smc hinge domain 0.00039
Further Details:      
 
Domain Number 2 Region: 83-251,1164-1266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.94e-45
Family ABC transporter ATPase domain-like 0.00016
Further Details:      
 
Domain Number 3 Region: 857-1090
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000641
Family Tropomyosin 0.0034
Further Details:      
 
Domain Number 4 Region: 450-600
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000981
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341382-1
Sequence length 1285
Comment SMC4 (Homo_sapiens) structural maintenance of chromosomes 4
Sequence
MPRKGTQLSTARRKEKRTPSSPDPGSSDSESELPSGRAESPAVAAAETSGEQLDNRSLEE
ILNSIPPPPPPAMTNEAGAPRLMITHIVNQNFKSYAGEKILGPFHKRFSCIIGPNGSGKS
NVIDSMLFVFGYRAQKIRSKKLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVIPN
SNFYVSRTAYRDNTSVYHISGKKKTFKDVGNLLRSGIDLDHNRFLILQGEVEQIAMMKPK
GQTEHPWVSLYGLEDIIGCGRLNEPIKVLCRRVEILNEHRGEKVNLVKMVEKEKDALEGE
KNIAIEFLTLENEIFRKKNHVCQYYIYDLQKRIAEMEIQKEKIHEDTKEINERNNILSNE
MKAKNKAVQDTEKKLNKITKFIEENKEKFTQLDLEDVQVREKLKHATSKGKKLEKQLQKE
KEKVEEFKSIPAKSENIITESTTRNNSLEKEKEREEKKLKEVMDSLIQETQGLQKEKESR
EKELMAFNKSVNEARSKMEVAQSELDIYLSRYNTAVSQLSKAKEALIAASETLKERKAAI
GNIEAKLPQTEQALKAKEKELKKLAQEEMNFKTLVRDLFQKVEEAKSSLAMNRSRGKVLD
AIIQEKKSGRIPGIYGRLGDLGAIDEKYDVAISSSCHALDYIVVGFIDTAQECVNFLKRQ
NIGVATFIGLDKMAVWAKKMTKIQTPENVPRLFDLVKVKDEEIRQAFYFALRDTLVADNL
DQATRVAYQKDRRWRVVTLQGQIIEQSGTMTGGGSKVMKGRMGSSVVEISEEEVNKMESQ
LQRDSKKATQIQEQKVQLEEAVVKLRHDEREMKNTLEKFTASIQRLSEQEEYLSVQVKEL
EANVLATAPDKKKQRLLEENVSTFKTEYDGVAEKAGKVEAEVKRLHNIIVEINNHKLKAQ
QDKLDKINKQLDECASAITKAQVAIKTADRNLKKAQDSVFRTEKEIKDTEKEVHDLTAEL
RSLEDKATEVIKNTNAAEESLPEIQKEHRNLLQELKVIQDNEHALQKDALSVKLKLEQID
GHIAEHNSKIKYWRKEISKISLHPIEDNPVEEVSVLSPEDLEAVKNPDSVTNQIALLEAQ
CHEMKPNLGAIAEYKKKEELYLQRVAELDKITSERDNFRQAYEDLRKQRLNEFMAGFYII
TNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLA
LVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISDRL
IGIYKTYNITKSAVNPKEIASKGLC
Download sequence
Identical sequences G5AQ82
HGL_H00000341382-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]