SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341382-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341382-2
Domain Number 1 Region: 144-195,268-468
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-33
Family ABC transporter ATPase domain-like 0.0000614
Further Details:      
 
Domain Number 2 Region: 45-280
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000916
Family Tropomyosin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341382-2
Sequence length 474
Comment SMC4 (Homo_sapiens) structural maintenance of chromosomes 4
Sequence
MNTLEKFTASIQHLSEQEEYLSVQVKELEANVLATAPDKKKQRLLEENVSTFKTEYDGVA
EKAGKVEAEVKRLHNIIVEINNHKLKAQQDKLDKINKQLDECASAITKAQEAIKTADRNL
KKAQDSVFCTEKEIKDTEKEVHDLTAELRSLEDKATEVIKNTNAAEESLPEIQKEHRNLL
QELKVIQNNEHALQKDALSVKLKLEQIDGHIAEHNSKIKYWRKEISKISLHPIEDNPVEE
ISVLSPENLEAVKNPDSIINQIALLEAQCHEMKPNIGAIAEYKKKEELYLQRVTELDKIT
SERDNFRQAYEDLRKQRRNKFMAGFYIITNKLKENYQMLTLGRDAELELVDSLDPFSEGI
MFSVQPPKKSWKKILNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVA
FYIYEQTKNAQFIIISLRNNMFEISDRLIGIYKTYNITKSAAVNPKEIASKGLC
Download sequence
Identical sequences G5BPN7
HGL_H00000341382-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]