SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341382-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341382-3
Domain Number 1 Region: 113-164,293-458
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.87e-26
Family ABC transporter ATPase domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 4-79
Classification Level Classification E-value
Superfamily Smc hinge domain 1.09e-17
Family Smc hinge domain 0.0024
Further Details:      
 
Domain Number 3 Region: 70-305
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000209
Family Tropomyosin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341382-3
Sequence length 469
Comment SMC4 (Homo_sapiens) structural maintenance of chromosomes 4
Sequence
MSGRIPGIYGRLGDLGATDEKYEVAISSYCHALAYIVVDSIDTAQECVNFLKRQNIGVAT
FIGLEKQKLLEENVSTFKTEYNGVAEKDGKVEAEVKRLHNIIVEINNHKLKAQQNKLDKI
NKQLDECASAITKAQEAIKTADRNLKKAQDSVFCTEKEIKDTEKEVHGLTEELRSLENKA
TEVIKNTNAAEESLPEIQKEHLNLLQELKVIQNNEHALQKDALSVKLKLEQIDGHIAEHN
SKIKYWQKEISTISLHPIEDNPVEEISVLSPENLEAVKNPDSIINQIALLEAQCHEMKPN
IGAIAEYKKKEELYLQRVTELDKITSERDNFRQAYENLLKQRLNEFMAGIMFSVQPPKKS
WKKIFNLSGGEKTLSSLALVFALHRYKPTPLYFMDEIDAALDFKNVSIVAFYIHEQTKNA
QFIIISLRNNVFEISDRLIGIYKTYNITKSVAVNPKEIASKDFVELGLF
Download sequence
Identical sequences G5C0A0
HGL_H00000341382-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]