SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341479 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341479
Domain Number 1 Region: 171-368
Classification Level Classification E-value
Superfamily E set domains 9.33e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000141
Further Details:      
 
Domain Number 2 Region: 69-187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341479
Sequence length 434
Comment KCNJ14 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 14
Sequence
MGLARALRRLSGALEPGDSRAGGEEEAGPGLCRNGWAPAQGPGTRRRGRLVKKDGHCNVR
FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAAPP
PPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG
AVMAKMAKPKKRNETLVFSENAVVALRDRRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT
PEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHKIDSASPLYELGRAELARADFELVVI
LEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQHGSQYEVDYRHFHRTYEVPGTPVCS
AKELDERAEQAAHSPKSSFPGSLAAFCYENELALTCCQEEDEEEETKEGTGAETEDGAAS
PQVLTPTLALSLLP
Download sequence
Identical sequences G5B8A9
HGL_H00000341479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]