SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341489 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341489
Domain Number 1 Region: 470-679
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.0000759
Further Details:      
 
Weak hits

Sequence:  HGL_H00000341489
Domain Number - Region: 341-460
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00167
Family PLC-like (P variant) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341489
Sequence length 816
Comment SYDE1 (Homo_sapiens) synapse defective 1, Rho GTPase, homolog 1 (C. elegans)
Sequence
MLKVKIRAPLMRTAAIASDSKDLSSDDNENSQVHFRKTMTSFSKKINNKQSSPPGPGQLH
LPATPARAAGRGREKKVWAKQAEPLLRKTFSRLRGREKLPRKKSDSKERGRPAQHPEPSP
PEPQALEGPQAGAEGPLRPEAPRSPARGVYLQSLEPSSRRWVLGGAKPPEEVPLGPGIPS
SGEPAGEIWYNPIPEEDPRPPAPEPLWPQPGSAEPENPTHQGAAPASPPTKTSRTKSPGP
ARRLSMKMKKLPELRRRLSLRGPKAGRERERAAPEGSVITRYHLDSSVGNPRRMAAAGST
QSARAVYLSDSDSPERPAGPPSPAAFRPYEAGPAARVLPAALWGRLSLHLYGLGGLRPTP
GATPRDLCCLLQVDGVARARTGPLRGGPDFLQLDHTFHLELEAARLLRALVLAWDPGVRR
HRPCAQGTVLLPTVFRGCQAQQLAIRLEPQGLLYAKLTLSDQQEASATAEPRVFGLPLPL
LVEREQPPGQVPHIIQKCVAQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSEAVCLSE
DLYPDINVITGILKDYLRELPTPLITQPLYQVVLEAMARGPPSRIPPSPEGTRGLLSCLP
DVEKATLTLLLDHLRLVSSFQAHNRMTPQNLAVCFGPVLLPARQASARPRIRSCGTGVTS
AVDFKRHIEVLHYLLQSWPDPRQSPEAPDVAPYLRPKRQPSLHLPLTGPEVVTRPRGRGG
PESPPSNRYAGEWSVCGRDFLPCGRDFLSGPAYDHVTGSHSDEDDDDDDEAGEQRGAADF
EDEFDAPFNPHLNLKDFDALILDLERELSKQLNVCL
Download sequence
Identical sequences G5BYQ4
HGL_H00000341489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]