SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341762 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341762
Domain Number 1 Region: 69-124
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000148
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 2 Region: 36-77
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000234
Family Fibronectin type II module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341762
Sequence length 127
Comment BSPH1 (Homo_sapiens) binder of sperm protein homolog 1
Sequence
MRYLVGWVALAICMCGLNADLIAHLHHRIPGFPIRSCVFPFTYGDVLYYNCISVHSDFAW
CSFDRNFQGRWWYCTAMDPPNCTFPFYFRGEVFHKCTKKGYVLNRSSCSLTADYNKDKKW
KQCSPQK
Download sequence
Identical sequences G5B896
HGL_H00000341762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]