SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342019 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342019
Domain Number 1 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 196-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.71e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.05e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 154-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 518-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-20
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 7 Region: 438-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 120-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 11-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000353
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 10 Region: 378-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000517
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 11 Region: 299-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000457
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 561-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000035
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342019
Sequence length 610
Comment ZNF189 (Homo_sapiens) zinc finger protein 189
Sequence
MASPSSPLEPKEEWDYLDPAQRSLYKDVMMENYGNLVSLDVLNRDKDEEPAVKQEIEELE
EVEPQGVIVTRIKSEIDQDPMGRETFELVGRLDKQRGIFLWEIPRESLTQEQKMFRGNSN
IQKKSNTEEKCHKCEECGKGFVRKAHFIQHQRVHTGEKPFQCNECGKSFSRSSFVIEHQR
IHTGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQSFSQRRSLVKHQRIHTG
EKPHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSRNSLLVEHQRIHTGERPH
KCGECGKAFRLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFLIEHQRIHTGERPYQCKE
CGKSFSQLCNLTRHQRIHTGHKPHKCEECGKAFSRSSGLIQHQRIHTREKTYPYNETKES
FDPNCSLVIQQEVYPKEKSYKCDECGKTFSVSAHLVQHQRIHTGEKPYLCTVCGKSFSRS
SFLIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHTGNKPHKCEECGKAFSRNSGLT
QHQRIHTGEKPYKCEKCDKSFSQQRSLVNHQKIHAEVKTQETYECDACGEAFNCHISLIQ
HQKLHTAWMQ
Download sequence
Identical sequences G5ANC3
HGL_H00000342019 XP_004848267.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]