SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342169 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342169
Domain Number 1 Region: 210-373
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000981
Family Tropomyosin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342169
Sequence length 407
Comment TEX9 (Homo_sapiens) testis expressed 9
Sequence
MEKSHNQPPGYPELIAQEETKQMNEALEKFKAEVISQISADIYRDGIAGPCVEKQGYNLY
SLQVNQTQEDDKWNCVEFIQLILEFISQINYFIVNYLLKRLNAELEAKTADLVRQAEEAI
RDQQEVQSRPFSTQNKSYGAEDSGSISVKLKYCNVQTASDVAIPEDFSDFSLAKTISKIE
GQLEEEGLPEHTDDEIFSGVSKDIGTKAQIRFLKAKLHVMREELDNVVCECNKKEDDIQD
LKSQVKNFEEDGARQQRTINIQQSQIEKYKNLFEDANKKCDGLQQQLSSVERELENKERL
QKQAATSRSATEVRLNRALEEVEKYKLELSKLKQNNKDIANEEHKKIEVLKSENKKLEKQ
KEELMIGFKKQLKLIDVLKRQKMHIEAAKMLSFTEEEFMKALEWGNS
Download sequence
Identical sequences G5B7F4
HGL_H00000342169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]