SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342848 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342848
Domain Number 1 Region: 395-462
Classification Level Classification E-value
Superfamily SH3-domain 9.98e-17
Family SH3-domain 0.0007
Further Details:      
 
Domain Number 2 Region: 305-388
Classification Level Classification E-value
Superfamily CAD & PB1 domains 6.47e-16
Family PB1 domain 0.0092
Further Details:      
 
Domain Number 3 Region: 12-154
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000001
Family Tetratricopeptide repeat (TPR) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342848
Sequence length 468
Comment NOXA1 (Homo_sapiens) NADPH oxidase activator 1
Sequence
MRSLGEQVRDWHRGAEAVARGNWGGALRLFSGVTKMPSRMSFNVGCVHLLAGDPEAALRA
FDQAVTKDTCMAVGFLQRGVAHFQLERFQEALSDFQLALAQLRGNSVIDYTQLGLRFRLQ
AWEVLYNVASAQCQLGLWAEAADTLAEAVSRWPEKAQEGLTAALYQVQKQAPLQPRQVPP
GEVFRPHRRYLEHLEPMDFLGKAKVVVPAIPDDRPAGVQPPQAPSLGPQRSLEPRGARTH
DSSQAAAREASSDPTGRADCCLPVTSQDTRSQVAPAGKPGPRSTGLPGPGPSQDPVSTRG
AAAHSEDSAMVTVQCTLTVGLQAPRGAGLASLRALLAEALPAQARQAQLSYWAPEDGKLW
VPIPGEDTLQKAWRDAASSPRGLRLQCRGAGGRPVLYQVLAQHDYLAQSPEDLDLRRGDL
VDVLGEVDEAWLEGHRDGNVGIFPKSFVVPASGEVPAPAPGPQQEDWL
Download sequence
Identical sequences G5BFZ6
XP_012929292.1.39548 HGL_H00000342848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]