SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342970 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342970
Domain Number 1 Region: 776-957
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-45
Family SPRY domain 0.0033
Further Details:      
 
Domain Number 2 Region: 603-700
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-17
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 317-370
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000198
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 97-137,221-256
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000435
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000342970
Domain Number - Region: 260-294
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0701
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342970
Sequence length 966
Comment TRIM9 (Homo_sapiens) tripartite motif-containing 9
Sequence
MTTPLSHPPSNDPRLLGGAGLGGRRGRALASSQRCGSAAHTESASQGAGARTTREGTSSA
AAAAGQGAGRDRPVGYPSSPGIRGCTCCSLASSQVPMEEMEEELKCPVCGSFYREPIILP
CSHNLCQACARNILVQTPESEPPQSRRASGSGVSDYDYLDLDKMSLYSEADSGYGSYGGF
ASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNSCITCPQCHRSLILDDRGLRG
FPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPL
AKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVK
ALGAMWKLHKRLPAGRDEGDSDVALPIWCTAEGSGQLRVHTGKLLSPESCCGPASEGVSW
AALPSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRR
KAQLLARVNKEHEHKLKHWSSGDICCPSIALREVVRDQISHCTVKLRQTTGLMEYCLEVI
KENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQV
KASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPAEGYILELDDGSGGQFREVYVGK
ETMCTVDGLHFNSTYNARVKAFNKTGVSLYSKTLVLQTSEDTDSEEQTPPFPVPSERLPL
RRMSPFSSTLNLQPSFPGRSYFDFRSSPHQLSLHSSLQSLNAPGCNFETQSAPYSQLGKY
IYFDIKKLLAVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELT
IDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKG
ATIGVLLDLNRKTLTFFINDEQQGPIAFENLEGLFFPAVSLNRNVQVTLHTGLPVPDFYS
SRASIA
Download sequence
Identical sequences G5BLN5
HGL_H00000342970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]