SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342974-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342974-1
Domain Number 1 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-18
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 4 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-16
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 2-41
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000275
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 165-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000114
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 7 Region: 106-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000064
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342974-1
Sequence length 415
Comment ZNF791 (Homo_sapiens) zinc finger protein 791
Sequence
MEEWVLLNPSQKKLYRDVMEETFRNIVAIGRAWDNQEVEEDYKNYWRNLRNEEVEKCFQN
KGWNQFEEIFLCTPDANVDKKQAGLTPAESLACKKPPIGHLSLNVPIIAHTGLNTSDLGL
EEMYKCNEHGKTYDFQSFQKDAKTKTGEKPYEYDQCGKSYPDINESIHLREKTFVYKKNL
KATSTYSDVQIHERNHNGGKLYVCMQCGKAFNTQGIHTGEKPYVCKQCGKAFTQDYCKIH
ERIHTGEKPYVCKQCGKAFNTQYYCKIHERIHTGEKPYVCRQCGKAFVIRGYCKRHERIH
TGEKPYVCKQCGKAFTKRGYCKTHERIHTGEKPYVCMQCGKAFSTHDDCQRHESTHSQEK
PYVCKQCGKAFLTPSKCQRHERIHTGEKPYICKQCGKAFNTASGCKKHERTHTRH
Download sequence
Identical sequences G5AYK3
HGL_H00000342974-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]