SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342974-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342974-2
Domain Number 1 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 429-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 206-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0006
Further Details:      
 
Domain Number 5 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-20
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 376-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-19
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 7 Region: 163-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-19
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 333-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 134-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000106
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 94-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000155
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 250-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000579
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342974-2
Sequence length 527
Comment ZNF791 (Homo_sapiens) zinc finger protein 791
Sequence
QDSVAFEDVSVDFTQEEWALLDPLQKKLYRDVMWETFRNLAYVGSKWEDQQIKDQYKKQG
RNLRSYLIQRLCESKEDGQYGETLSRISDPTRTKKTTGVKPYKCSVCGKGFMLHSSLTRH
IKSHPGHELDGFRYGEKPYKCKECGNTFSYLKSFQRHERNHTGENPYKCKQCGKTFIYHQ
PFQTHELMHIGEKPYQCKHCGKALSSPSSLRIHERIHTGEKPYECKKCGKAFSCPSSIQI
HERTHTGEKPYTCKECGKAFISRTSVQTHMITHNGNRPYKCKECGKAFIRPSFLRVHERI
HTGEKPYKCKQCGKAFRCSTSIQIHERTHTGEKPYKCKECGKAFSARPAFRVHTRVHTGE
KPYKCKECGKAFSRLSYYLQIHERNHTGEKPYECKECAKAFISLENFRRHMITHTGDGPY
KCRECGKPFIFLSALRTHERTHTGEKPYACKQCGKAFSCSSYVQIHERTHTGEKPYECKE
CGKAFIYPTSFQGHMRMHTGEKPYKCKQCGRAFSLRSSFQRHERTHS
Download sequence
Identical sequences G5BYS1
HGL_H00000342974-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]