SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343054 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343054
Domain Number 1 Region: 36-171
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.87e-20
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 2 Region: 218-314
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000725
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 3 Region: 171-206
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000628
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Weak hits

Sequence:  HGL_H00000343054
Domain Number - Region: 634-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00935
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343054
Sequence length 810
Comment RBM5 (Homo_sapiens) RNA binding motif protein 5
Sequence
RVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSPERERE
RRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQ
PADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDW
LCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAPHTVVD
SIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPPLKIDG
KTIGVDFAKSARKDLVLPDGNRVSAFSVASTAIAAAQWSSTQSQSGEGGSVDYSYLQPGQ
DGYAQYAQYSQDYQQFYQQQAGGLESDVSSVSGSKLTTTSAAVVSQSPQLYNQTSNPPGS
PTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQ
YYYNSLTQQYLYWDGEKETYVPAAESSSHQQTGLPPAKEGKEKKEKPKSKTAQQIAKDME
RWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIPELVRN
GDEENPLKRGLVAAYSGDSDNEEDLVERLESEEEKLADWKKMACLLCRRQFPNRDALIRH
QQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRKKQ
FDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLG
AKGSAYGLSGADSYKDAVRKAMFARFTEME
Download sequence
Identical sequences G5BZY2
HGL_H00000343054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]