SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343325-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343325-2
Domain Number 1 Region: 616-929
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.47e-91
Family Protein kinases, catalytic subunit 0.0000000483
Further Details:      
 
Domain Number 2 Region: 213-288
Classification Level Classification E-value
Superfamily HR1 repeat 1.83e-23
Family HR1 repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 129-199
Classification Level Classification E-value
Superfamily HR1 repeat 2.49e-23
Family HR1 repeat 0.0000212
Further Details:      
 
Domain Number 4 Region: 22-101
Classification Level Classification E-value
Superfamily HR1 repeat 4.71e-19
Family HR1 repeat 0.0000115
Further Details:      
 
Domain Number 5 Region: 325-341,391-481
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000151
Family PLC-like (P variant) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343325-2
Sequence length 946
Comment PKN1 (Homo_sapiens) protein kinase N1
Sequence
MAEGDPPSEQELESEPWSLLEHLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGA
ENLRRAATDLGRGRGPVELLLRGSARRLDLLHRQLQELHAHVVLPEPTAGQDVPQSPGAG
SSTCLATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTK
IDIIRMQLRRALQAGQLESQAASDEAPGGPDLGAVELRIEELRHHFRVEHAVAEGAKNVL
RLLSAAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLREELAAAS
SAAFSALLTGPFPAAQYSTLCKPAPLTGTLEVRVVGCRDLPENIPWNPLPSGTPGTPDSR
TPFLSRPGRGLYSRSGSLSGRSSLKAEAENTGEVSTVLKLDNTVVGQTSWKPCGSSTWDQ
SFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLLAEVTFH
NPVIERIPRLQRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATATGTFSPAAS
PGPEARPVGDISVEKLSLGPDPDSSAQKNPSGQLSRASSLGSPSQAMATVPKLPSETQET
PGPSLCSSLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDE
VESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPR
AIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFC
GTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPR
FLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWDVLLARQLPPPFVPKLS
GRTDVSNFDEEFTGEAPTLSPPRDARPLSAAEQAAFQDFDFVPGGC
Download sequence
Identical sequences G5BYS7
HGL_H00000343325-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]