SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343362 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343362
Domain Number 1 Region: 640-905
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.88e-55
Family Ankyrin repeat 0.00021
Further Details:      
 
Domain Number 2 Region: 133-321,352-434
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.03e-44
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 360-626
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.58e-43
Family Ankyrin repeat 0.00049
Further Details:      
 
Domain Number 4 Region: 1017-1076
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.01e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 
Domain Number 5 Region: 876-996
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000129
Family Ankyrin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343362
Sequence length 1082
Comment ANKFY1 (Homo_sapiens) ankyrin repeat and FYVE domain containing 1
Sequence
EEVAKLEKHLMLLRQEYVKLQKKLAETEKRCTLLAAQANKESSSESFISRLLTIVADLYE
QEQYRCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASHWDDLRKEDFSSMSAQ
LLYKMIKSKTEYPLHKAIKVEREDVVFLYLIEMDSQLPGKLNEVDHNGDLALDLALSRRL
ESIATTLVSHKADVDMVDKNGWSLLHKGIQRGDVFASTFLIKNGALVNAATLGAQETPLH
LVALYTSKKHSAETMSEMAQIAEALLQAGANPNMQDSKGRTPLHLSIMARNEYVFNQLLQ
CKQLDLELKDHEGSTALWLAVQYITVTSDQSVNPFEDLLVINGTSFDENSFAARLIQCGS
NTDAPDTVTGNCLLQRAAGAGNEAAALFLATNGAHVNHKNKWGETSLHTACQHGLANLTA
ELLQQGANPNLQTEEAVSLSKAAVSLTGSMDSVYLQTPLHMAIAYNHPDVVSVILEQKAN
ALHATNNLQIIPDFSLKDSRDQTVLGLALWTGMHTIAAQLLGSGASINDTMSDGQTLLHM
AIQRQDSKSALFLLEHQADINVSRTQDGETALQLAIRNQLPLVVDAMCTRGADMSVSDEK
GDPPLWLALANNLEDIASTLVRHGCDATCWGPGPSGCLQTLLHRAIDENNESTACFLIRS
GCDVNSPRQPGADGEGEEEARDGQTPLHLAASWGLEETVQCLLEFGANVNAQDAEGRTPV
HVAISNQHSVIIQLLISHPDIHLNVRDRQGLTPFACAMTYKNNKAAEAILKRESGAAEQV
DNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPLHLAVQAGSEIIVRNLLL
AGAKVNELTKHRQTALHLAAQQDLPTICSVLLENAVDFAAVDENGNNALHLAVMHGRLNN
IRVLLTECTVDAEAFNLRGQSPLHILGQYGKENAAAIFDLFLECMPEYPLDKPDTEGNTV
LLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDG
SNCYECTAKFGVTTRKHHCRHCGRLLCHKCSTKEIPIIKFDLNKPVRVCNICFDVLTLGG
VS
Download sequence
Identical sequences G5B925
HGL_H00000343362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]