SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343377 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343377
Domain Number 1 Region: 440-665
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000654
Family Tropomyosin 0.0012
Further Details:      
 
Weak hits

Sequence:  HGL_H00000343377
Domain Number - Region: 243-448
Classification Level Classification E-value
Superfamily Tropomyosin 0.0144
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343377
Sequence length 870
Comment CCDC18 (Homo_sapiens) coiled-coil domain containing 18
Sequence
MNSLSSKEESCVGCCEANKLMISELRIKLAIKEAEIQKLHANLTANQLSQNLTSSKDSQE
SGKLNMFETEPVKLGGNQIAERIKDRSQHTVNKQYEREKQKLATGIEELRTKLMQIEAEN
SDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEEKNEKIRSLETNINTEHEKICLAFEK
AKKIHLEQHKEMEKQIERHTLQQQQQMLQQETNRNGELEDIQTKLEKQVSKLEQELQKQR
ESSAEKLRKMEEKCEAAVHDADLKRQKIIELTRTSRQIKLEMDQYKEELSKMEKEIMHLK
RDGENKTMHLSQLDVILDQTKTELEKKTSAVKELEKLQQHSENELTETLQRRDVLETELQ
NAHRDLKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRDCKMEIEDKKQELLEMDQ
ALKERNWELKQRAAQVTHLDMTIHEHRAEMEQKIIKLEGTLEKSELEFKECNKQIESLNE
KLQSAKEQLREKEFIMLQSEQEIGQLKKEAERTQQRIKEMEKVMKEQEQYIAAQYKEARD
LGQELRLTQEQLQNAHTELVEAHRQQVQAQRQIEKLTSELEDIRQLSKEKVISHQENHAK
WTISADSQKTSVQQLNEQLEKAKLELEEAQDTVSNLHQQVQDRNEGIEATNEALLIKESE
LTKLQAKISGHEKAEDIKFLLAPFTPPKETMPDIQDPEFAKHPHTSFFKCRKLRCSISAS
DLYFKSQSNEDLSEELLQDFKKVQLKQPSTLEESQKDLIFTQPDSFKPLTYNLEDDRSES
NDFSTLSGMLRYINKEVGLLKNSSMPTGAGLTQVCISYIISCNNLSLVNIILLLQGKFVQ
GLSKFPKCLGPEVFQISSDSGRFKFFRYHA
Download sequence
Identical sequences G5B6A0
HGL_H00000343377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]