SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343581-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343581-2
Domain Number 1 Region: 318-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 247-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 359-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-20
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 150-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343581-2
Sequence length 415
Comment ZFP30 (Homo_sapiens) zinc finger protein 30 homolog (mouse)
Sequence
QGSVMFSDVSIIFSQEEWEYLDREQRNLYRNVMMENYSNLVSLAGCFISKPDVITLLEQG
KDPWKVVRKGRKRYSDLETSHETKKLLSVNNSYEFNLSQWKIMERIKTRSLKDLLLKNDC
ESKRKFEEQEGPQADYFNQVKVISEKISSYKKRTSVTPHQKIHFVEKPYECKECGKAFRV
RQQLTFHFRIHTGEKPYECKECGMAFRQTAHLTRHQRLHTGEKLYECKECGEAFICGPDL
RIHQKIHVGEKPYECKECGKAFRVRGQLTLHQRIHTGEKPYVCKECGKAFRQYAHLTRHQ
KLNIADRVYECKECGKDFLCGSGLRVHHKLHTGEKPYECKECGKAFRVRQQLTLHQRIHT
GEKPYECKECGKTFSRGYHLILHHRIHTGEKPYECKECWKAFSRYSQLISHQSIH
Download sequence
Identical sequences G5BWE9
HGL_H00000343581-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]