SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343966 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343966
Domain Number 1 Region: 21-156
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-35
Family Canonical RBD 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343966
Sequence length 289
Comment PSPC1 (Homo_sapiens) paraspeckle component 1
Sequence
MGFTIDIKSFLKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFG
FIRLESRTLAEIAKAELDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFG
PVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDD
EDGLPEKLMQKTQQYHKEQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAKE
KLEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQLR
Download sequence
Identical sequences G5BKW4
HGL_H00000343966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]