SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000344914 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000344914
Domain Number 1 Region: 778-976
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-47
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 1045-1241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.52e-44
Family BAR domain 0.0033
Further Details:      
 
Domain Number 3 Region: 245-308
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 1534-1595
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-17
Family SH3-domain 0.0000233
Further Details:      
 
Domain Number 5 Region: 125-205
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000127
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 6 Region: 1310-1386
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.00000817
Further Details:      
 
Domain Number 7 Region: 4-63
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000106
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 8 Region: 66-129
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000433
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000344914
Sequence length 1598
Comment DNMBP (Homo_sapiens) dynamin binding protein
Sequence
METGSVVRAVFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKKEDVTGQFPSSFVEVVT
IPTLKEGERLFICISEFTSQELSSLPLHRGDLVILNDDTPTADWLQGRSCWGSRGFFPSS
CVRELFLSSHSQQWHTHSALLEIPEYSMGQARALMGLSAQLDEELNFREGDVITIIGVPE
PGWFEGELEGRRGIFPEGFVELLGPLRTVDESITSGNQDDCVANGEVDMTLGEEEKGLEE
EDEQPGAYGIALYRFQALEPNELDFEVGDKIRILATLEDGWLEGCLKGRTGIFPHRFVKL
CPNARTEEPIALSQEGSLTKAPESSWDALENSLVAETPGHESHEYKAEETSCGLPENSTT
LLNHLTPEYDINENSSQDEGTSGELPRSPGTELEKPPSKDSDMTHYLEAVSGVSSQPQVP
FHSKLQKNQYNSTAEGDHQSSEQFSDLPVEARTRDYSTLPPRGTCAQRSSQRKPLAPLHR
GSSLTASRVAHPNQLSPQFQGMAKCTKKHHTSKENTSSFSSTSGRSERKPGPQGKGPAVA
VIALSHGDGSTDLDSKLTQQLIEFEKSLSASATEPDKILRHFSIMDFNSEKDIVQGSSKS
IPSQDLPERRKALRPPPPRPHTPTSTSPHLLVDQSPKPVPPLPVRPSRPAPLPPAQQRLN
AASPNPLSCHCPSFKTLEKEGPEHVEQSLDQTSPCPLVLVRIQEMEQDLDMYTRAQEELS
LMLEEKQDASLRAETLEDLEFFESNIESLNLGLQQLREITPLSSQSSSLVAPSGSVSTEN
PEQRMLEKRTKVVEELLQTERDYIRDLEMCIERVMVPLQQAQVPNIDFEGLFGNMQMVIK
VSKQLLAALEISDAVGPVFLDHRDDLEGTYKIYCQNHDEAISLLEIYEKDEKIQKHLQDS
LADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPELHPDKVPLTNAVLA
VKEINVHINEYKRRKDLGKQSIIAKRRLLAHIIQPQERLTILTSSLVLKYRKGDEDSLME
KISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKTFRMQERLIKSFIRDLSLY
LQHIRESACVKVVAAASMWDLCIERGHRDLEQFEKVHRYISDQLFTNFKERTERLVISPL
NQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDE
LPKFQQYAQGLFANCIHGYAEAHCDFVQQALEQLQPLVSLLKVTGKEGNLIAIFHEEHSR
VLQQLQVFTFFPESLPATKKPFERKTTDRQSARKSLLGLPSYMLQSEELRASLLARYPPD
KLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYN
PRHSHSDASVGSHSSTESEHSSSSPRFLRQNSNSTLTFNPSSMAVSFASASCPKQPQDIP
SLKECDQGTLGASLNLSSPENGPSRSLPDPEWTLQPRPRDSVDVASIRGCYRSTRHPEVV
LSRNGQGRDLAKGCAIAAQALEDKNEKLESSEAEGSQVYFAVYTFKARNPNELSVSANQR
LKILEFKDITGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Download sequence
Identical sequences G5AYP2
HGL_H00000344914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]