SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000344950 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000344950
Domain Number 1 Region: 28-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.26e-24
Family La domain 0.00071
Further Details:      
 
Domain Number 2 Region: 107-184
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.22e-20
Family Canonical RBD 0.0035
Further Details:      
 
Domain Number 3 Region: 441-546
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000354
Family Canonical RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000344950
Sequence length 577
Comment LARP7 (Homo_sapiens) La ribonucleoprotein domain family, member 7
Sequence
MEAEGGNQAMEESSEKKEVEKKKRSRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKS
RDGYVDISLLVSFNKMKKLTTDGKLIARALKSSAIVELDLEGTRIRRKKPLGERPKDEDE
RTVYVELLPKNVNHSWIEKVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIE
FLNNPPEEAPRKPGIFPKTVKNKPIPVLRVAEEKKKKKKKKGRMKKEDNVQEKGLSMDTS
SVSICKVKASRTTSEGSETESAEPQKQHTKKKKKRDRAEVSSLPEGRPEKRKRSSSADAA
ESLAPKSKIKKIAPKNVKKEASEVSKDNRDLEFSTEEEKDTGDIQGSLLKTKRKHKKKHK
ERHKMGEEVIPLRVLSKNEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSGVPSK
IAVKKEEANGPECRPQEKVNPPGPQFLSGVIVKITSPEPLPGRKQLRDTLAAISEVVYVD
LLEGDTECHARFKTPEAAQGIMNRHTEIKKKHSWELEVLTGDHEQRYWQKILVDRQAKLN
QPREKKRGTEKLITKAEKIRLEKTQQASKHIRFSEYD
Download sequence
Identical sequences G5BMD7
XP_004867653.1.39548 XP_004867654.1.39548 XP_004867655.1.39548 HGL_H00000344950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]