SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345055 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345055
Domain Number 1 Region: 39-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.07e-43
Family Voltage-gated potassium channels 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345055
Sequence length 864
Comment KCNQ5 (Homo_sapiens) potassium voltage-gated channel, KQT-like subfamily, member 5
Sequence
MSLLGKPLSYSSGQSCRRNAKYRRVQNYLYNVLERPRGWAFVYHAFVFLLVFGCLILSVF
STIPEHTKLASSCLLILEFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVID
TIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKEL
ITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRL
LSAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEK
SVSIATWKPHLKALHTCSPTKKEQGETASSKLCSNKQKLFRMYTSRKQSQKLSFKERVRM
ASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLKSSQPKPV
IDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVK
DVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEQETTDDLSMLGRVV
KVEKQVQSIESKLDCLLDIYQQVLRKGSASALTLASFQIPPFECEQTSDYQSPVDSKDLS
SSAQNSGCLTRSASANISRGLQFILTPNEFSAQTFYALSPAMHSPVTQVPMSQSDSSTVA
ASNIANQITTAPKPVAPTTLQIPPPLPAIKHLPRPETLHPNPTGLQESISDATTCLVSSK
ENIQVAQSNLTKDRSLRKSFDTGGETLLSILPTVSKDLGKSLSVQNLIRSTEELNLQLSG
SESSGSRGSQDFYPKWRESKLFITDEEVCAEETETDTFDGTPQPAKEAAFPTDSLRTGRS
RSSQSICKAGESSDALSLPHVKLK
Download sequence
Identical sequences G5ALU0
HGL_H00000345055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]