SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345065 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345065
Domain Number 1 Region: 8-327
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-65
Family Ankyrin repeat 0.0000754
Further Details:      
 
Domain Number 2 Region: 362-461
Classification Level Classification E-value
Superfamily DEATH domain 2.09e-20
Family DEATH domain, DD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345065
Sequence length 472
Comment ANKDD1B (Homo_sapiens) ankyrin repeat and death domain containing 1B
Sequence
MFPQMNRTALHFAVGGKNFSAVNFLLNHKARVDIADKHGLTAIHLAAWSGSFEIMLMLVK
AGADQRATSQDGWNALHFAAQSNSVHIVEYLIQDLHLQELNQSDQRGRKPFLLAAGRGHV
EMIEKLAFLNLHTLEKDKEGNTALHLAAMHGHSPAVQVLLTQWQEVDVTNENGETPFFLA
VAGGHEECSKVLLAAGSDINILNKAWIPCLLSLCLLQLNVSALQTATQNGQASLVNFLLS
ENIKLPQRMEPKESPLHLAVSNNHIAVVNSLLSAQHDTDILDQRQRTPLHVAADLGNVEL
VETLLKAGCDLKIVDKQGRTALAVAASLVVDMLIKAERYHAWREEYLQDASAGFALTFKQ
DHSLETRHIRTLLWNLAYRQLKPNEWQRLARSWDFTDDQIRAIEEQWTGSESFREHGHRA
LLIWLHGALMTQQDPDKHLYAELVRAGFPELAEKIRQVKSKADSSSRKCAIS
Download sequence
Identical sequences G5AK83
HGL_H00000345065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]