SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345193-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345193-1
Domain Number 1 Region: 45-271
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.13e-45
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 451-547
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-17
Family PDZ domain 0.0000217
Further Details:      
 
Domain Number 3 Region: 1405-1470
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2e-16
Family SAM (sterile alpha motif) domain 0.000064
Further Details:      
 
Domain Number 4 Region: 385-415
Classification Level Classification E-value
Superfamily SH3-domain 0.000000174
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345193-1
Sequence length 1473
Comment SHANK2 (Homo_sapiens) SH3 and multiple ankyrin repeat domains 2
Sequence
MVRKLQFHKWKLLRQKNFLNGEFRYKRRVYAQNLIDDKQFAKLHTKANLKKFMDYVQLHS
TDKVARLLDKGLDPNFHDPDSGECPLSLAAQLDNASDLLKVLRNGGAHLDFRTRDGLTAV
HCATRQRNAGALTTLLDLGASPDYKDSRGLTPLYHSALGGGDALCCELLLHDHAQLGTTD
ENGWQEIHQACRFGHVQHLEHLLFYGANMGAQNASGNTALHICALYNQESCARVLLFRGA
NKDVRNYNSQTAFQVAIIAGNFELAEIIKTHKDSDVVPFRETPSYAKRRRLAGPSGLASP
RPLQRSASDINLKGEAQPAVSPGPSLRSLPHQLLLQRLQEEKDRDRDGDQENAGGPSAGR
GSQSKIRWGPVARAGSETCPDIEPVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQYDT
RHETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAVLQKRDHEGFGFVLRGAKAETPI
EEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGN
RLAMKVVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAELEELEKLDEILAAAAE
PTLRPDIADADSRAATVKQRPTSRRITPAEISSLFERQGLPGPEKLPGSLRKGIPRTKSV
GEDEKLASLLEGRFPRSTSMQDSGREGHGIPPPFSPPPPPPGRAYDTVRSSFKPGLEARL
GTGAAGLYEPSALGPLPYPERQKRARSMIILQDSAPEVGDVPRPGLAATPPERPKRRPRP
PGPDSPYANLGAFSASLFAPSKPQRRKSPLVKQLQVEDAQERAALAVGSAGPSGGSFARE
PSPTHRGPRSGGLDYGASDRLGLAFGGPGPGPGKERRLEERRRSTVFLSVGAIEGSPPSA
DLPSLQPSRSIDERLLGAGATPGRDLLLPSPVSSLKPLVSGPSLGLSGSTFIHPLTGKPL
DPSSPLALALAARERALASQAPSRSPTPVHSPDADRPGPLFVDVQARDSERGALASPAFS
PRSPAWIPVPARRESEKAPREERKSPEDKKSMILSVLDTSLQRPAGLIVVHATSNGQEPS
RLGAEEERPGTPELAPAPMQTAAVAEPLPSPRAQPPGSAPADSGPGQGSSEEEPELVFAV
NLPPAQLSSSDEETREELARIGLVPPPEEFANGILLATPPPGPGPSPTTMPSPASGKPSS
EPPPAPESAADSGVEEADTRSSSDPHLETTSTISTVSSMSTLSSESGELTDTHTSFADGH
TFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSSDSELMAQQHHAASAGLASAAGPARP
RYLFQRRSKLWGDPVESRGLPGPEDDKPTVISELSSRLQQLNKDTRSLGEEPVGGLGGLL
DPAKKSPIAAARPGAPGPRRPFQQKPLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAH
LPALTKDDFVELGVTRVGHRMNIERALRQLDGS
Download sequence
Identical sequences G5B2F6
HGL_H00000345193-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]