SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345436 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345436
Domain Number 1 Region: 16-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.21e-55
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 509-580
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.93e-20
Family SAM (sterile alpha motif) domain 0.0054
Further Details:      
 
Domain Number 3 Region: 279-347
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000289
Family SH3-domain 0.0041
Further Details:      
 
Domain Number 4 Region: 459-507
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000746
Family SAM (sterile alpha motif) domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345436
Sequence length 1390
Comment CASKIN1 (Homo_sapiens) CASK interacting protein 1
Sequence
MLDNTFCREELLGSTKKINVNFQDPDGFSALHHAALNGNTELISLLLEAQAAVDIKDNKG
KTGPEPLGQGQKIKVRGMRPLHYAAWQGRKEPMKLVLKAGSAVNVPSDEGHIPLHLAAQH
GHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPRPGDTT
DPNGTSPLHLAAKNGHIDIIRLLLQAGIDINRQTKSGTALHEAALCGKTEVVRLLLDSGI
NAQVRNTYSQTALDIVHQFTTSQASKEIKQLLREASAALQVRATKDYCNNYDLTSLNVKA
GDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSSLGSRVGSEPSPSQGGSSSGPSGPPE
EIWVLRKPFAGGDRSGSLSSVAGGRSGGGHTLHAGSEGVKLLATVLSQKSVSESSPGDSP
VKPPEGTTGAARSQPPVAHTGQGYVEQPPKKLEPASEGKLQLYAPNFTSAGYDLPTISRM
TPEDLTAIGVTKPGHRKKITAEISGLNIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNG
YENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKYEGGPLHRKAPQSL
KMMAIESPPPPEPAPTDCQSPKMTTFQDSELSGELQAAMTGPADGGTAEKPSNHLPPTPK
ATSRQEPSLGGRARHMSSSQELLGEGPPGPGSPMSRSQEYLLDEGQAPGTLPKEVRSGRH
GHHIKRASVPPVPGKPRQVLPPGGSHFTPPQTPTKARPGSPQALTGPHGPAPVTAKVKPT
PQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPVEGDTGPATPAPVPQTMPAAVPTLCLPP
EAEAEPGRPKKRAHSLNRDSEPERDELLVPAAAGPYATVQRRVGRSHSVRAPTGTDKNVN
RSQSFAVRPRKKGPPPPPPKRSSSAMASANLADEPAQDAETDEDQLGVKAQRRRASDLAG
SVDTGSAGSVKSIAAMLELSSIGGGGRAARRPPEGHPTPHPASPGPGRVATVLASVKHKE
AIGPDGEVVNRRRTLSGPVTGLLATARRGSVEPTGGGHFVEDGKARQQPQGPGKGEASVD
GPPLARVEASATLKRRIRAKQNQQENVKFILTESDTVKRRPKAKEREAGSEPLPSLSVYQ
NGTATVRRRPALEQAGPPELPPPPPPAEPPPTDLAHLPPLPLPEGDARKPAKPPVSPKPV
LTQPVPKIQGSPTPSSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPAKAAAGLQ
SGSASSSPAPSPARQPXXXXXXXXXXXXXXXXXXXXXAAAAAAATAAATAGATAALEGTS
PSPGDSARQKLEETSACLAAALQAVEEKIRQEDGQGPRPSAVAEKSTGSILDDIGSMFDD
LADQLDAMLE
Download sequence
Identical sequences G5BY43
HGL_H00000345436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]